PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037028m
Common NameCISIN_1g037028mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 504aa    MW: 56374.8 Da    PI: 6.9865
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037028mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.83.6e-1131315011374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPil 91 
                        lv++L++cAeav+ +d++ a+alL++l+ +a   g+++qR+a++f+++L+ rla  ++  +  +  s+++++  +se+  +l+l +e++P +
  orange1.1g037028m 131 LVQQLIACAEAVACRDKAHASALLSELRVNALVFGTSFQRVASCFVQGLSDRLALVQPLGAVGVVGSAAKSMAiTSERDESLSLVYEICPQI 222
                        689***************************************************95554444455555555556899999999********* PP

               GRAS  92 kfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                        +f+h++aN  Ilea+ege+ vH++D++++    +G QW +L+q+L +R+++ p +l+iTgvg+     +e+l e+g+ L+++A+ l+++fef
  orange1.1g037028m 223 QFGHFVANASILEAFEGESLVHVVDLGMTlglpHGRQWHSLMQSLVNRSGKVPkRLKITGVGN----CSERLGEIGDELKRYADGLKLNFEF 310
                        *************************99873333678*************77666*********....9************************ PP

               GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         + v+k+le+l+ ++++v+ gE+l+ n++l+lh +++es    +   +vL+ + +lsPkvv +veq+++hn++ Fl rf+eal+yysa+fds
  orange1.1g037028m 311 LA-VEKSLETLQAKDINVEDGEVLVMNSILELHCVVKESRGALN---SVLQRLHQLSPKVVMLVEQDSSHNGPFFLGRFMEALHYYSAIFDS 398
                        **.7********************************88877777...8******************************************** PP

               GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                        l+a lp+ + +r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF++vp++  + +qak  lrkv+  +gy++ ee+g+lvlg
  orange1.1g037028m 399 LDAMLPKYDTKRAKIEQFYFAEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQSVPIK--MLMQAKQWLRKVQtCEGYTIIEEKGCLVLG 488
                        **********************************************************96..789*************************** PP

               GRAS 362 WkdrpLvsvSaWr 374
                        Wk++p++++S+W+
  orange1.1g037028m 489 WKSKPIIAASCWK 501
                        ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.037105482IPR005202Transcription factor GRAS
PfamPF035141.2E-110131501IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MAPDFQWRHG LCLDDKDNEA MGLDLNYSAT ACYRCFNLST LANHSCTWST SDETRNHKRI  60
KKTSMIDESS GSSSRLCNSL NSLPRLQFRD HVWVYTQRYL AIEAMEEAAL AMMIDKDTEV  120
KEEGNGDGMK LVQQLIACAE AVACRDKAHA SALLSELRVN ALVFGTSFQR VASCFVQGLS  180
DRLALVQPLG AVGVVGSAAK SMAITSERDE SLSLVYEICP QIQFGHFVAN ASILEAFEGE  240
SLVHVVDLGM TLGLPHGRQW HSLMQSLVNR SGKVPKRLKI TGVGNCSERL GEIGDELKRY  300
ADGLKLNFEF LAVEKSLETL QAKDINVEDG EVLVMNSILE LHCVVKESRG ALNSVLQRLH  360
QLSPKVVMLV EQDSSHNGPF FLGRFMEALH YYSAIFDSLD AMLPKYDTKR AKIEQFYFAE  420
EIKNIVSCEG PARVERHERV DQWRRRMSRA GFQSVPIKML MQAKQWLRKV QTCEGYTIIE  480
EKGCLVLGWK SKPIIAASCW KCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-501305013375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484335.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLA0A067H3B10.0A0A067H3B1_CITSI; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16018814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.19e-78GRAS family protein